Furin (Paired basic amino acid cleaving enzyme)

UniProt : Q6GTN6, UniProt ID: Q6GTN6_MOUSE,

Furin (Paired basic amino acid cleaving enzyme)

Mus musculus

MELRSWLLWVVAAAGAVVLLAADAQGQKIFTNTWAVHIPGGPAVADRVAQKHGFHNLGQI
FGDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVTACLGEPNH
ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLSTPPESSGCKTLTSSQACVVCE
EGYSLHQKSCVQHCPPGFIPQVLDTHYSTENDVEIIRASVCTPCHASCATCQGPAPTDCL
SCPSHASLDPVEQTCSRQSQSSRESRPQQQPPALRPEVEMEPRLQAGLASHLPEVLAGLS
CLIIVLIFGIVFLFLHRCSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGR
GERTAFIKDQSAL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Furin (Paired basic amino acid cleaving enzyme) contains a PF00082 domain.

Furin (Paired basic amino acid cleaving enzyme) contains a PF01483 domain.

Furin (Paired basic amino acid cleaving enzyme) is proteolytically cut by furin (S08.071) cleavage. RAKR-DVYQ.