Bacteriocin microcin B17

UniProt : P05834, UniProt ID: MCBA_ECOLX,

Bacteriocin microcin B17

Escherichia coli

MELKASEFGVVLSVDALKLSRQSPLGVGIGGGGGGGGGGSCGGQGGGCGGCSNGCSGGNG
GSGGSGSHI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Bacteriocin microcin B17 is proteolytically cut by microcin-processing peptidase 1 (U62.001) cleavage. SPLG-VGIG.