Bovine viral diarrhea virus (strain CP7)

MELITNELLYKTYKQKPAGVEEPVYDQAGNPLFGERGVIHPQSTLKLPHKRGEREVPTNL
ASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLEFFEEASMCETTKRIGR
VTGSDSRLYHIYVCIDGCIIVKSATKDRQKVLKWVHNKLNCPLWVSSCSDTKDEGVVRKK
QQKPDRLEKGRMKITPKESEKDSKTKPPDATIVVDGVKYQVKKKGKVKSKNTQDGLYHNK
NKPQESRKKLEKALLAWAIIALVFFQVTMGENITQWNLQDNGTEGIQRAMFQRGVNRSLH
GIWPEKICTGVPSHLATDTELKAIHGMMDASEKTNYTCCRLQRHEWNKHGWCNWYNIEPW
ILLMNKTQANLTEGQPLRECAVTCRYDRDSDLNVVTQARDSPTPLTGCKKGKNFSFAGIL
VQGPCNFEIAVSDVLFKEHDCTSVIQDTAHYLVDGMTNSLESARQGTAKLTTWLGRQLGI
LGKKLENKSKTWFGAYAASPYCEVERKLGYIWYTKNCTPACLPRNTKIIGPGRFDTNAED
GKILHEMGGHLSEVLLLSVVVLSDFAPETASVIYLILHFSIPQGHTDIQDCDKNQLNLTV
ELTTAEVIPGSVWNLGKYVCVRPDWWPYETATVLVIEEVGQVIKVVLRALKDLTRIWTAA
TTTAFLVCLVKVVRGQVLQGILWLMLITGAQGYPDCKPGFSYAIAKNDEIGPLGATGLTT
QWYEYSDGMRLQDSVVEVWCKNGEIKYLIRCGREARYLAVLHTRALPTSVVFEKIFDGKE
QEDIVEMDDNFEFGLCPCDARPLIRGKFNTTLLNGPAFQMVCPIGWTGTVSCTLANKDTL
ATIVVRTYKRVRPFPYRQDCVTQKTIGEDLYDCALGGNWTCVPGDALRYVAGPVESCEWC
GYKFLKSEGLPHFPIGKCRLKNESGYRQVDETSCNRNGVAIVPSGTVKCKIGDTVVQVIA
MDDKLGPMPCKPHEIISSEGPVEKTACTFNYTRTLKNKYFEPRDNYFQQYMLKGEYQYWF
DLEITDHHRDYFAESLLVIVVALLGGRYVLWLLVTYMILSEQMASGVQYGAGEIVMMGNL
LTHDSVEVVTYFLLLYLLLREENTKKWVILIYHIIVMHPLKSVTVILLMVGGMAKAEPGA
QGYLEQVDLSFTMITIIVIGLVIARRDPTVVPLVTIVAALKITGLGFGPGVDAAMAVLTL
TLLMTSYVTDYFRYKRWIQCILSLVAGVFLIRTLKHLGELKTPELTIPNWRPLTFILLYL
TSATVVTRWKIDIAGIFLQGAPILLMIATLWADFLTLVLILPTYELAKLYYLKNVKTDVE
KSWGVPYPDPQTLGGLDYRTIDSVYDVDESGEGVYLFPSRQKKNKNISILLPLIRATLIS
CISSKWQMVYMAYLTLDFMYYMHRKVIEEISGSTNVMSRVIAALIELNWSMEEEESKGLK
KFFILSGRLRNLIIKHKVRNQTVASWYGEEEVYGMPKVVTIIRACTLNKNKHCIICTVCE
ARKWKGGNCPKCGRHGKPIICGMTLADFEERHYKRIFIREGNFEGPFRQEYNGFVQYTAR
GQLFLRNLPILATKVKMIMVGNLGEEIGDLEHLGWILRGPAVCKKITEHEKCHVNILDKL
TAFFGVMPRGTTPRAPVRFPTALLKVRRGLETGWAYTHQGGISSVDHVTAGKDLLVCDSM
GRTRVVCQSNNKLTDETEYGVKTDSGCPDGARCYVLNPEAVNISGSKGAVVHLQKTGGEF
TCVTASGTPAFFDLKNLKGWSGLPIFEASSGRVVGRVKVGKNEESKPTKLMSGIQTVSKN
TADLTEMVKKITSMNRGDFRQITLATGAGKTTELPKAVIEEIGRHKRVLVLIPLRAAAES
VYQYMRLKHPSISFNLRIGDMKEGDMATGITYASYGYFCQMPQPKLRAAMIEYSYIFLDE
YHCATPEQLAVIGKIHRFSESIRVVAMTATPAGSVTTTGQKHPIEEFIAPEVMKGEDLGS
QFLDIAGLKIPVEEMKGNMLVFVPTRNMAVEVAKKLKAKGYNSGYYYSGEDPANLRVVTS
QSPYVVVATNAIESGVTLPDLDTVVDTGLKCEKRVRVSSKIPFIVTGLKRMAVTVGEQAQ
RRGRVGRVKPGRYYRSQETATGSKDYHYDLLQAQRYGIEDGINVTKSFREMNYDWSLYEE
DSLLITQLEILNNLLISEDLPAAVKNIMARTDHPEPIQLAYNSYEVQVPVLFPKIRNGEV
TDTYENYSFLNARKLGEDVPVYVYATEDEDLAVDLLGLDWPDPGNQQVVETGKALKQVVG
LSSAENALLIALFGYVGYQALSKRHVPMITDIYTIEDQRLEDTTHLQYAPNAIRTEGKET
ELKELAVGDLDKIMGSISDYASEGLNFVRSQAEKMRSAPAFKENVEAAKGYVQKFIDSLI
ENKETIIRYGLWGTHTALYKSIAARLGHETAFATLVIKWLAFGGESVSDHMRQAAVDLVV
YYVINKPSFPGDSETQQEGRRFVASLFISALATYTYKTWNYNNLSKVVEPALAYLPYATN
ALKMFTPTRLESVVILSTTIYKTYLSIRKGKSDGLLGTGISAAMEILSQNPVSVGISVML
GVGAIAAHNAIESSEQKRTLLMKVFVKNFLDQAATDELVKENPEKIIMALFEAVQTIGNP
LRLIYHLYGVYYKGWEAKELSERTAGRNLFTLIMFEAFELLGMDSEGKIRNLSGNYVLDL
IYSLHKQINRGLKKIVLGWAPAPFSCDWTPSDERIRLPTNNYLRVETKCPCGYEMKALRN
VGGSLTKVEEKGPFLCRNRLGRGPVNYRVTKYYDDNLKEIKPVAKLEGFVDHYYKGVTAR
IDYGRGKMLLATDKWEVEHGVVTRLAKRYTGVGFKGAYLGDEPNHRDLVERDCATITKNT
VQFLKMKKGCAFTYDLTLSNLTRLIELVHKNNLEEKDIPAATVTTWLAYTFVNEDIGTIK
PVLGERVVTDPVVDVNLQPEVQVDTSEVGITLVGRAALMTTGTTPVVEKTEPNADGGPSS
IKIGLDEGRYPGPGLQDRTLTDEIHSRDERPFVLVLGSKNSMSNRAKTARNINLYKGNNP
REIRDLMAQGRMLVVALKDFNPELSELVDFKGTFLDREALEALSLGRPKSKQVTTATVRE
LLEQEVQVEIPSWFGAGDPVFLEVTLKGDRYHLVGDVDRVKDQAKELGATDQTRIVKEVG
ARTYTMKLSSWFLQATNKQMSLTPLFEELLLRCPPKIKSNKGHMASAYQLAQGNWEPLDC
GVHLGTIPARRVKIHPYEAYLKLKDLLEEEEKKPKCRDTVIREHNKWILKKVRHQGNLNT
KKILNPGKLSEQLDREGHKRNIYNNQIGTIMTEAGSRLEKLPVVRAQTDTKSFHEAIRDK
IDKNENQQSPGLHDKLLEIFHTIAQPSLRHTYSDVTWEQLEAGVNRKGAAGFLEKKNVGE
VLDSEKHLVEQLIRDLKTGRKIRYYETAIPKNEKRDVSDDWQSGDLVDEKKPRVIQYPEA
KTRLAITKVMYNWVKQQPVVIPGYEGKTPLFNIFNKVRKEWDLFNEPVAVSFDTKAWDTQ
VTSRDLRLIGEIQKYYYRKEWHKFIDTITDHMVEVPVITADGEVYIRNGQRGSGQPDTSA
GNSMLNVLTMMYAFCESTGVPYKSFNRVARIHVCGDDGFLITEKGLGLKFANNGMQILHE
AGKPQKITEGERMKVAYRFEDIEFCSHTPVPVRWSDNTSSYMAGRDTAVILSKMATRLDS
SGERGTIAYEKAVAFSFLLMYSWNPLVRRICLLVLSQQPETTPSTQTTYYYKGDPIGAYK
DVIGKNLCELKRTGFEKLANLNLSLSTLGIWSKHTSKRIIQDCVTIGKEEGNWLVNADRL
ISSKTGHLYIPDKGYTLQGKHYEQLQLQARTSPVTGVGTERYKLGPIVNLLLRRLRVLLM
AAVGASS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by (XS26-001) cleavage. MASG-VQYG.

is proteolytically cut by pestivirus NS3 polyprotein peptidase (S31.001) cleavage. TMKL-SSWF.

is proteolytically cut by pestivirus NS3 polyprotein peptidase (S31.001) cleavage. IRNL-SGNY.

is proteolytically cut by pestivirus NS3 polyprotein peptidase (S31.001) cleavage. LKEL-AVGD.

is proteolytically cut by pestivirus NS3 polyprotein peptidase (S31.001) cleavage. VVGL-SSAE.