Zinc finger CCHC domain-containing protein 8

UniProt : Q9CYA6, UniProt ID: ZCHC8_MOUSE,

Zinc finger CCHC domain-containing protein 8

Mus musculus

MAAGVDFGDLELFEAFDPPEESTPKPVHTRFKDDEEEEDDDDDENGVGDAELQEQLRRCE
ATIEQLRAENQELKRKLNILTRPSGILVSNTKIDGPLLQILFMNNAISKQYHQEIEEFVS
NLVKRFEEQQKNDVEKTSFSLLPQPSSVMLEEDHKVEESCAVKNNKEAFSVVGSVLYFTN
FCLDKLGQPLLNENPQLTEGWEIPKYQQVFSHIVPLEGQEMQVKAKRPKPHCFNCGSEEH
QMKECPMPRNAARISEKRKEYMDACGEASGQSFQQRYHAEEVEERFGRFKPGVISEELQD
ALGVTDKSLPPFIYRMRQLGYPPGWLKEAELENSGLALYDGNDDADGETETGEIQNKNVT
YDLSKLVNYPGFNISTPRGIPDEWRMFGSIPMQACQQKDVFASYLNSNIQSPSMRSSGKR
SSSQSSPNSPKKQRKEGSAAASPADMELDSDVEIPPGSQSSKAFQFQPPLPPGTPPPLPQ
GTPPPLFTPPLPKGTPPLTPSDSPQARPAASAMDEDALTLEELEEQQRQIWAALQQAEGG
NGDSDVPGDTPLTGNSVASSPCPNEFDLPVPEGKALEKPVLAEPQEPAASVDTAGPEPSC
SPAAGAAVLSQREEEAAAEGGPGDALLDNGGVLNMNMSNGSNQQPIHPDSRPPMAPKTHS
PVPDMSKFATGITPFEFENMAESTGMYLRIRNLLKNSPRNQQKNKKTCE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Zinc finger CCHC domain-containing protein 8 contains a PF00098 domain.

Zinc finger CCHC domain-containing protein 8 contains a PF04046 domain.

Zinc finger CCHC domain-containing protein 8 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. MDED-ALTL.