CEA-related cell adhesion molecule 1

UniProt : Q925P3, UniProt ID: Q925P3_MOUSE,

CEA-related cell adhesion molecule 1

Mus musculus

MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQVAEDNNVLLLVHNLPL
ALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVY
TLDMTDENYRRTQATVRFHVHPILLKPNITSNNSNPVEGDDSVSLTCDSYTDPDNINYLW
SRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPFSLNIIYGPD
TPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYT
CFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNTTVKELDSVTLTCLSNDIGANIQWLFN
SQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDIIFDPTQGG
LSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGGSDQRDLTEHKPSASNHNLAPSDNSP
NKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEVKKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CEA-related cell adhesion molecule 1 contains a PF00047 domain.

CEA-related cell adhesion molecule 1 contains a PF00047 domain.

CEA-related cell adhesion molecule 1 contains a PF00047 domain.

CEA-related cell adhesion molecule 1 contains a PF07686 domain.

CEA-related cell adhesion molecule 1 is proteolytically cut by caspase-3 (C14.003) cleavage. DQRD-LTEH.