Heterogeneous nuclear ribonucleoproteins A2/B1

UniProt : P22626, UniProt ID: ROA2_HUMAN,

Heterogeneous nuclear ribonucleoproteins A2/B1

Homo sapiens

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKR
SRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIK
EDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGH
NAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGF
GDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNY
NDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Heterogeneous nuclear ribonucleoproteins A2/B1 contains a PF00076 domain.

Heterogeneous nuclear ribonucleoproteins A2/B1 contains a PF00076 domain.

Heterogeneous nuclear ribonucleoproteins A2/B1 is proteolytically cut by caspase () cleavage. AEVD-AAMA.