14-3-3 protein theta

UniProt : P27348, UniProt ID: 1433T_HUMAN,

14-3-3 protein theta

Homo sapiens

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

14-3-3 protein theta contains a PF00244 domain.

14-3-3 protein theta is proteolytically cut by caspase-3 (C14.003) cleavage. EECD-AAEG.

14-3-3 protein theta is proteolytically cut by caspase-7 (C14.004) cleavage. EECD-AAEG.

14-3-3 protein theta is proteolytically cut by caspase-8 (C14.009) cleavage. EECD-AAEG.