Interpain A

UniProt : A9J7N5, UniProt ID: A9J7N5_PREIN,

Interpain A

Prevotella intermedia

MEKPSSKCSSFPIGYSFFKHIYMKIKQNLFVAFVLLMLVPTFAWAKPRTKEQMKKTAASA
INLQTTLGKHKMNAPQQGGKRTVNQLRELKQTHTYTVFGYTDGGFAVISADDLAPELLGV
SESNFVETDNPSFKWWLKAIDEVITNAVKNNKPLSVIKPDPSKYAAEVSTLLTTTWGQQM
PYNKLLPNTKKGRLITGCVATATAQALNYFKYPVRGIGSHTVHYPANDPSGVAISADFGN
TTYDWANMKDDYSGNYTEAEANAVATLMLHCGVASEMQYGGPNEGSGAYMTDCAAGLRTY
FGFTDAEYITRADYTDEQWMDIVFSELTKGHPLIYGGVSPGSMGQDAGHAFVIDGYNKAG
LVSVNWGWNGDVDGYYKIDLLNPGNMYSFTAEQDMVRGVYGKPKDLEKRTINLTKAGMLA
ESIPADMREKIGELTLTGDINGSDFRVIREMAGCDYAGKFTQGGLSMLDIKGARIVSGGE
AYLKDGQLTTTNDNLPERVFYGCNSLRKIVLPDGLKTISDGTFALCRALEAVDNIPAGGG
DNFVYENGIFYTKDRKEIISVVPSAKGDLVVAEGITTLRNYALAGCIGIKRLVLPTTITN
LGNESMAGCHSLAEIKIFAKQPPKVGKDPLLSSRINSIILRVPIDTKKTYRGWAGIPYRN
IKEFGSIVTVRNTVRAYGEANPKFGYSVRGEYFEGKPEITCEANEKSPVGKYDIRIDYGT
ITDKSIQLVGGVLTVDKATLTVSTDNVTRQEGKPNPEFVLHYRGFTNGENDQVLTVRPTA
STTATETSPAGEYDIIISGGEAQNYKFSYKKGKLTVLTAAGIDHADASDAATPQTVYSVS
GAKVGTTASLSSLPRGVYIVNNKKVVVK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interpain A contains a PF01640 domain.

Interpain A is proteolytically cut by interpain A () cleavage. GKRT-VNQL.

Interpain A is proteolytically cut by interpain A () cleavage. KPLS-VIKP.

Interpain A is proteolytically cut by interpain A () cleavage. WLKA-IDEV.

Interpain A is proteolytically cut by interpain A () cleavage. WWLK-AIDE.