Lantibiotic streptococcin A-FF22

UniProt : P36501, UniProt ID: LANA_STRPY,

Lantibiotic streptococcin A-FF22

Streptococcus pyogenes

MEKNNEVINSIQEVSLEELDQIIGAGKNGVFKTISHECHLNTWAFLATCCS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Lantibiotic streptococcin A-FF22 contains a PF04604 domain.

Lantibiotic streptococcin A-FF22 is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. IIGA-GKNG.