Coagulogen

UniProt : P02681, UniProt ID: COAG_TACTR,

Coagulogen

Tachypleus tridentatus

MEKKLFGIALLLTTVASVLAADTNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQE
SGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKLECPVSTRDCEPVFG
YTVAGEFRVIVQAPRAGFRQCVWQHKCRFGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFL
CESFRTCCGCPCRSF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Coagulogen contains a PF02035 domain.

Coagulogen is proteolytically cut by clotting enzyme (S01.221) cleavage. VSGR-GFSI.

Coagulogen is proteolytically cut by clotting enzyme (S01.221) cleavage. VLGR-TQIV.