Colipase

UniProt : P04118, UniProt ID: COL_HUMAN,

Colipase

Homo sapiens

MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMA
SENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Colipase contains a PF01114 domain.

Colipase contains a PF02740 domain.

Colipase is proteolytically cut by (M9E.004) cleavage. APGP-RGII.