Sakacin P (SppA)

UniProt : P35618, Q7B5F5, UniProt ID: Q7B5F5_LACSK, SAKP_LACSK,

Sakacin P (SppA)

Lactobacillus sakei

MEKFIELSLKEVTAITGGKYYGNGVHCGKHSCTVDWGTAIGNIGNNAAANWATGGNAGWN
K

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sakacin P (SppA) contains a PF01721 domain.

Sakacin P (SppA) is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. ITGG-KYYG.