cDNA FLJ77020, highly similar to Homo sapiens neuregulin 1 (NRG1), transcript variant SMDF, mRNA (Neuregulin 1, isoform CRA_e)

UniProt : A8K1L2, Q15491, UniProt ID: A8K1L2_HUMAN, SMDF_HUMAN,

cDNA FLJ77020, highly similar to Homo sapiens neuregulin 1 (NRG1), transcript variant SMDF, mRNA (Neuregulin 1, isoform CRA_e)

Homo sapiens

MEIYSPDMSEVAAERSSSPSTQLSADPSLDGLPAAEDMPEPQTEDGRTPGLVGLAVPCCA
CLEAERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIFEYDSPTHLDPGGLGQD
PIISLDATAASAVWVSSEAYTSPVSRAQSESEVQVTVQGDKAVVSFEPSAAPTPKNRIFA
FSFLPSTAPSFPSPTRNPEVRTPKSATQPQTTETNLQTAPKLSTSTSTTGTSHLVKCAEK
EKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYSTSTPFLSLPE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77020, highly similar to Homo sapiens neuregulin 1 (NRG1), transcript variant SMDF, mRNA (Neuregulin 1, isoform CRA_e) contains a PF00008 domain.

cDNA FLJ77020, highly similar to Homo sapiens neuregulin 1 (NRG1), transcript variant SMDF, mRNA (Neuregulin 1, isoform CRA_e) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..