Neuregulin-1 type III beta1-a

UniProt : Q6DR99, UniProt ID: Q6DR99_MOUSE,

Neuregulin-1 type III beta1-a

Mus musculus

MEIYPPDMSEGAGGRSSSPSTQLSADPSLDGLPAAEHMPDTHTEDGRSPGLLGLAVPCCV
CLEAERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIFEYDSPTHLDPGGLGQD
PVISLDPTAASAVLVSSEAYTSPVSKAQSEAEAHVTGQGDHVAVASEPSAVPTRKNRLSA
FPPLHSTPPPFPSPARTPEVRTPKSGTQPQTTETNLQTAPKLSTSTSTTGTSHLIKCAEK
EKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQ
KRVLTITGICIALLVVGIMCVVAYCKTKKQRQKLHDRLRQSLRSERNNMVNIANGPHHPN
PPPENVQLVNQYVSKNVISSEHIVEREVETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHT
ESIISESHSVIMMSSVENSRHSSPAGGPRGRLHGLGGPRECNSFLRHARETPDSYRDSPH
SERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSVAVSPFVEEERPLLL
VTPPRLREKKYDHHPQQLNSFHHNPAHQSTSLPPSPLRIVEDEEYETTQEYEPIQEPIKK
VTNSRRAKRTKPNGHIANRLEMDSNPSSVSSNSESETEDERVGEDTPFLGIQNPLAASLE
VAPAFRLAESRTNPAGRFSTQEELQARLSSVIANQDPIAV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Neuregulin-1 type III beta1-a contains a PF00008 domain.

Neuregulin-1 type III beta1-a contains a PF02158 domain.

Neuregulin-1 type III beta1-a is proteolytically cut by adamalysin-19 (M12.214) cleavage..