VIP peptides

UniProt : P48143, UniProt ID: VIP_CHICK,

VIP peptides

Gallus gallus

MEHRGASPLLLALALLSALCWRARALPPRGAAFPAVPRLGNRLPFDAASESDRAHGSLKS
ESDILQNTLPENEKFYFDLSRIIDRNARHADGIFTSVYSHLLAKLAVKRYLHSLIRKRVS
SQDSPVKRHSDAVFTDNYSRFRKQMAVKKYLNSVLTGKRSQEELNPAKLRGEAEILEPSF
SENYDDVSVDELLSHLPLDL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

VIP peptides contains a PF00123 domain.

VIP peptides contains a PF00123 domain.

VIP peptides is proteolytically cut by (S9G.073) cleavage. TRLR-KQMA.

VIP peptides is proteolytically cut by tryptase alpha (S01.143) cleavage. AVKK-YLNS.

VIP peptides is proteolytically cut by tryptase alpha (S01.143) cleavage. MAVK-KYLN.

VIP peptides is proteolytically cut by tryptase alpha (S01.143) cleavage. RLRK-QMAV.

VIP peptides is proteolytically cut by tryptase alpha (S01.143) cleavage. TRLR-KQMA.