Plasminogen

UniProt : P00747, UniProt ID: PLMN_HUMAN,

Plasminogen

Homo sapiens

MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Plasminogen contains a PF00089 domain.

Plasminogen contains a PF00051 domain.

Plasminogen contains a PF00051 domain.

Plasminogen contains a PF00051 domain.

Plasminogen contains a PF00051 domain.

Plasminogen contains a PF00051 domain.

Plasminogen contains a PF00024 domain.

Plasminogen is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

Plasminogen is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

Plasminogen is proteolytically cut by u-plasminogen activator (S01.231) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. CAAP-SFDC.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APPP-VVLL.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APPP-VVLL.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. IMAE-NRKS.

Plasminogen is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. APPP-VVLL.

Plasminogen is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SGTE-ASVV.

Plasminogen is proteolytically cut by t-plasminogen activator (S01.232) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VAPP-PVVL.

Plasminogen is proteolytically cut by (S9G.025) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by plasmin (S01.233) cleavage. LFEK-KVYL.

Plasminogen is proteolytically cut by t-plasminogen activator (S01.232) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by u-plasminogen activator (S01.231) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. CAAP-SFDC.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APPP-VVLL.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. IMAE-NRKS.

Plasminogen is proteolytically cut by plasmin (S01.233) cleavage. GNGK-GYRG.

Plasminogen is proteolytically cut by cathepsin D (A01.009) cleavage. VVLL-PDVE.

Plasminogen is proteolytically cut by cathepsin D (A01.009) cleavage. DVVL-FEKK.

Plasminogen is proteolytically cut by cathepsin D (A01.009) cleavage. LLKE-AQLP.

Plasminogen is proteolytically cut by thermolysin (M04.001) cleavage. TDPS-VRWE.

Plasminogen is proteolytically cut by thermolysin (M04.001) cleavage. PPVV-LLPD.

Plasminogen is proteolytically cut by kallikrein hK14 (S01.029) cleavage. LFEK-KVYL.

Plasminogen is proteolytically cut by kallikrein hK14 (S01.029) cleavage. TNPR-KLYD.

Plasminogen is proteolytically cut by neutral protease Npr599 () cleavage..

Plasminogen is proteolytically cut by inhA g.p. (M06.001) cleavage..

Plasminogen is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

Plasminogen is proteolytically cut by u-plasminogen activator (S01.231) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. CAAP-SFDC.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APPP-VVLL.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APPP-VVLL.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. IMAE-NRKS.

Plasminogen is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. APPP-VVLL.

Plasminogen is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SGTE-ASVV.

Plasminogen is proteolytically cut by t-plasminogen activator (S01.232) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VAPP-PVVL.

Plasminogen is proteolytically cut by (S9G.025) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by plasmin (S01.233) cleavage. LFEK-KVYL.

Plasminogen is proteolytically cut by t-plasminogen activator (S01.232) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by u-plasminogen activator (S01.231) cleavage. CPGR-VVGG.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. CAAP-SFDC.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APPP-VVLL.

Plasminogen is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. IMAE-NRKS.

Plasminogen is proteolytically cut by plasmin (S01.233) cleavage. GNGK-GYRG.

Plasminogen is proteolytically cut by cathepsin D (A01.009) cleavage. VVLL-PDVE.

Plasminogen is proteolytically cut by cathepsin D (A01.009) cleavage. DVVL-FEKK.

Plasminogen is proteolytically cut by cathepsin D (A01.009) cleavage. LLKE-AQLP.

Plasminogen is proteolytically cut by thermolysin (M04.001) cleavage. TDPS-VRWE.

Plasminogen is proteolytically cut by thermolysin (M04.001) cleavage. PPVV-LLPD.

Plasminogen is proteolytically cut by kallikrein hK14 (S01.029) cleavage. LFEK-KVYL.

Plasminogen is proteolytically cut by kallikrein hK14 (S01.029) cleavage. TNPR-KLYD.

Plasminogen is proteolytically cut by neutral protease Npr599 () cleavage..

Plasminogen is proteolytically cut by inhA g.p. (M06.001) cleavage..

Plasminogen is proteolytically cut by omptin (A26.001) cleavage. CPGR-VVGG.