RNA 3'-terminal phosphate cyclase

UniProt : Q9D7H3, UniProt ID: RTC1_MOUSE,

RNA 3'-terminal phosphate cyclase

Mus musculus

MEGQRVEVDGGIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMVR
DLCGGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVCLLMQVSMPCVLFAASPSELR
LKGGTNAEMAPQIDYTMMVFKPIAEKFGFTFNCDIKTRGYYPKGGGEVIVRVSPVKRLDP
INLTDRGSVTKIYGRAFVAGVLPLKVAKDMAAAAVRCIRKEIRDLYVSIQPVQEARDQAF
GNGSGIIIVAETSTGCLFAGSSLGKRGVNADKAGIEAAEMLLANLRHGGTVDEYLQDQLI
IFMALANGISRIKTGSVTLHTQTAIHFAEQLAKAKFTVKKSEEEEDATKDTYVIECEGIG
MANPHL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RNA 3'-terminal phosphate cyclase contains a PF01137 domain.

RNA 3'-terminal phosphate cyclase contains a PF05189 domain.

RNA 3'-terminal phosphate cyclase is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VEVD-GGIM.