Homo sapiens MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIR TGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAI RRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSR GQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDP The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. SPGN-IKDQ.
is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GIQG-LKGD.
is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPLG-ARGI.
is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GPLG-ARGI.
is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPLG-ARGI.