Complement C3

UniProt : Q01833, UniProt ID: CO3_NAJNA,

Complement C3

Naja naja

MEGMALYLVAALLIGFPGSSHGALYTLITPAVLRTDTEEQILVEAHGDSTPKSLDIFVHD
FPRKQKTLFQSRVDMNQAGSMFVTPTIKVPAKELNKDSKQNQYVVVKVTGPQVALEKVVL
LSYQSGFVFIQTDKGIYTPGSPVRYRVFSVDHNMHRMDKTVIVEFQTPEGIVVSSKPVNP
SGSIRPYNLPELVSFGTWKAVAKYEHSPEESYTAYFDVREYVLPSFEVRLQPSDKFLYID
GNKNFHVSITARYLYGKKVEGVAFVVFGVKIDDAKKSIPDSLTRIPIIDGDGEATLKRDT
LRSRFQDLNQLVGHTLYVSVTVITESGSDMVVTEQGGIHIVTSPYQIYFTKTPKYFKPGM
PYELTVYVTNPDGSPAAHVPVVSEAIHSEGTTLSDGTAKLILNTPLNIQSLPITVRTNHG
DLPRERQAIKSMTATAYQTQGGSENYLHVAITSTEIKPGDNLPVNFNVRGNANSLNQIKY
FTYLILNKGKIFKVGRQPRRDGQNLVTMNLHITPDLIPSFRFVAYYQVGNNEIVADSVWV
DVKDTCMGTLVVKGASSRDDRIQKPGAAMKIKLEGDPGARVGLVAVDKAVYVLNDKYKIS
QAKIWDTIEKSDFGCTAGSGQNNLGVFEDAGLALTTSTNLNTKQRSAAKCPQPANRRRRS
SVLLLDSKASKAAQFQDQGLRKCCEDGMHENPMGYTCEKRAKYIQEGDACKAAFLECCHY
IKGIRDENQRESELFLARSDFEDELFGDDNIISRSDFPESWLWLTEELTGEPNNQGISSK
TVPFYLRDSITTWELLAVGLSPTKGICVAEPYEITVMKDFFIDLRLPYSVVKNEQVEIRA
ILYNYADEDIYVRVELIYNPAFCSASTEGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDV
EVIASVRGELASDGVRKKLKVVPEGERKNIVTIIELDPSVKGVGGTQELTVIANKLDDKV
PDTEVETRISVLGDPVAQIIENSIDGSKLNHLIITPSGCGEQNMITMTPSVIATYYLDAT
GQWENLGVDRRTEAIKQIMTGYAQQMVYKKADHSYAAFTNRASSSWLTAYVVKVLAMASN
MVKDISHEIICGGVKWLILNRQQPDGVFKENAPVIHGEMLGGTKGAEPEASLTAFIVTAL
LESRSVCKEQINILDSSINKATDYLLKKYEKLQRPYTTALTAYALAAADRLNDDRVLMAA
STGRNRWEEYNARTHNIEGTSYALLALLKMKKFAEVGPVVRWLIDQKYYGGTYGQTQATV
MVFQALAEYEIQMPTHQDLNLDISIKLPEREVPERYSINDRNAVQARTVETKLNEDFTVS
ASGDGKATMTILTVYNAQLREDANVCNKFHLDVSVENVELNLKQAKGGKAALRLKICTRY
LGEVDSTMTIIDISMLTGFFPDAEDLKRLSNGVDRYISKFEIDNNMAQKGTVVIYLDKVS
HSEDECLHFKIHKHFEVGFIQPGSVKVYSYYNLDEQCTKFYHPDKETGLLNKICHGNICR
CAEETCSLLNQQKKIDLQLRIQKACAQNVDYVYKTKLLRIEEKDGNDIYFMDVLEVIKGG
TDRNAQAKARQYVSQRKCQEALNLKLDNDYLIWGLSSDLWPMKDDISYLITKNTWIERWP
NEDECQDEEFQNLCDDFAQLSNTLTIFGCPT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Complement C3 contains a PF00207 domain.

Complement C3 contains a PF01821 domain.

Complement C3 contains a PF07677 domain.

Complement C3 contains a PF07703 domain.

Complement C3 contains a PF07678 domain.

Complement C3 contains a PF01835 domain.

Complement C3 contains a PF01759 domain.

Complement C3 is proteolytically cut by complement component 2 (S01.194) cleavage. FLAR-SDFE.