Kex2-like protein

UniProt : P21661, Q547J8, UniProt ID: NEC2_MOUSE, Q547J8_MOUSE,

Kex2-like protein

Mus musculus

MEGGCGSQWKAAGFLFCVMVFASAERPVFTNHFLVELHKDGEEEARQVAAEHGFGVRKLP
FAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINM
NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNY
NADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRML
DQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKG
SIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKR
NPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSKRNQ
LHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPP
TGKLVLTLKTNACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPR
DDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPYID
QVVRDYQSKLAMSKKQELEEELDEAVERSLQSILRKN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kex2-like protein contains a PF00082 domain.

Kex2-like protein contains a PF01483 domain.

Kex2-like protein is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. RKKR-GYRD.