IGHG1 protein

UniProt : Q6PJ95, UniProt ID: Q6PJ95_HUMAN,

IGHG1 protein

Homo sapiens

MEFGLSWVFLVALLRGVQCQAQLVESGGGVVQPGSSLRLSCAASGFRFSNYGMHWVRQAP
GKGLEWVAVFSYDESDKYYAASVKGRFTISRDNSKNTLSLQMNSLRVEDTAVYYCAKDQK
PWYSNSWFLTNFDSWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD
KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI
EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK
TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEES
CAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMI
GQGA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

IGHG1 protein contains a PF07654 domain.

IGHG1 protein contains a PF07654 domain.

IGHG1 protein contains a PF07654 domain.

IGHG1 protein contains a PF07686 domain.

IGHG1 protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. CPAP-ELLG.

IGHG1 protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. APEL-LGGP.

IGHG1 protein is proteolytically cut by papain (C01.001) cleavage. CDKT-HTCP.

IGHG1 protein is proteolytically cut by pepsin A (A01.001) cleavage. LGGP-SVFL.