Caspase-15

UniProt : Q3T2L1, UniProt ID: Q3T2L1_PIG,

Caspase-15

Sus scrofa

MEESPGSGRHLERNLWRTPLKLPPLPIRLQETLDQLSPQELRDFRTILKNVDAEPRVKEL
RLELEGGNASGLAQLLAKYYDSEAARRVMVQVLQQLPRADLLPRWRSAAPAVVAAGQVIP
RKMAKRSYDCMEDELDCYDLSGSRKAFLMCVQKNRPGAEQDIQWMEEWLDQCHFERTLCI
DPNKMELLEKIRSFRDGLNEIKDGVGCCLVTLMSHGEEGFLKMNNGEKVSLEGIFEMFNN
KNCPALHEKPKIFIIQACRGERRDIGVETDDEPMDSDDVSEKRLPTFSDYFIIYPTRAAH
VALRDPHTGSVMIRAMSNVFQEYGNKWHIADFFTKVNNRVVHSEFNLQKEPVKVTLVMES
TLTKFVYF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Caspase-15 contains a PF00656 domain.

Caspase-15 contains a PF02758 domain.

Caspase-15 is proteolytically cut by caspase-15 (C14.038) cleavage. MDSD-DVSE.