IL18 protein

UniProt : Q14116, Q6FGY3, UniProt ID: IL18_HUMAN, Q6FGY3_HUMAN,

IL18 protein

Homo sapiens

MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

IL18 protein contains a PF00340 domain.

IL18 protein is proteolytically cut by caspase-3 (C14.003) cleavage. DMTD-SDCR.

IL18 protein is proteolytically cut by caspase-3 (C14.003) cleavage. DCRD-NAPR.

IL18 protein is proteolytically cut by caspase-1 (C14.001) cleavage. LESD-YFGK.

IL18 protein is proteolytically cut by caspase-3 (C14.003) cleavage. DMTD-SDCR.

IL18 protein is proteolytically cut by caspase-3 (C14.003) cleavage. DCRD-NAPR.

IL18 protein is proteolytically cut by caspase-1 (C14.001) cleavage. LESD-YFGK.

IL18 protein is proteolytically cut by caspase-1 (C14.001) cleavage. LESD-YFGK.