Ubiquitin conjugation factor E4 B

UniProt : O95155, UniProt ID: UBE4B_HUMAN,

Ubiquitin conjugation factor E4 B

Homo sapiens

MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNM
TPATSPIGASGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQV
DVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFL
SSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPD
RNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAA
SQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSSPSPPALASSP
QAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIET
CKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPR
SLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDY
FKYPLMALGELCETKFGKTHPVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVF
AEDDVKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSY
MAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTKIKLETVDPTYIFHPRCRITL
PNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRL
RAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFL
RRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSP
QALYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHP
LSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSG
KQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDE
RVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVEN
PEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIA
IEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILR
HLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ubiquitin conjugation factor E4 B contains a PF04564 domain.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-7 (C14.004) cleavage. MDID-GVSC.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-3 (C14.003) cleavage. MDID-GVSC.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-6 (C14.005) cleavage. VDVD-SGIE.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-7 (C14.004) cleavage. MDID-GVSC.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-3 (C14.003) cleavage. MDID-GVSC.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-6 (C14.005) cleavage. VDVD-SGIE.

Ubiquitin conjugation factor E4 B is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VDVD-SGIE.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-6 (C14.005) cleavage. VDVD-SGIE.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-7 (C14.004) cleavage. MDID-GVSC.

Ubiquitin conjugation factor E4 B is proteolytically cut by caspase-3 (C14.003) cleavage. MDID-GVSC.