PMAP: SubstrateDB : Low affinity immunoglobulin epsilon Fc receptor

Low affinity immunoglobulin epsilon Fc receptor

UniProt : P06734, UniProt ID: FCER2_HUMAN,

Low affinity immunoglobulin epsilon Fc receptor

Homo sapiens

MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Low affinity immunoglobulin epsilon Fc receptor contains a PF00059 domain.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. RAEQ-QRLK.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. EQQR-LKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. RAEQ-QRLK.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. LRAE-QQRL.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. DQMA-QKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. DQMA-QKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM15 peptidase (M12.215) cleavage..

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM28 peptidase (M12.224) cleavage..