Low affinity immunoglobulin epsilon Fc receptor

UniProt : P06734, UniProt ID: FCER2_HUMAN,

Low affinity immunoglobulin epsilon Fc receptor

Homo sapiens

MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Low affinity immunoglobulin epsilon Fc receptor contains a PF00059 domain.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. RAEQ-QRLK.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. EQQR-LKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. RAEQ-QRLK.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. LRAE-QQRL.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. DQMA-QKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. DQMA-QKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM15 peptidase (M12.215) cleavage..

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM28 peptidase (M12.224) cleavage..

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. RAEQ-QRLK.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. EQQR-LKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. RAEQ-QRLK.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. LRAE-QQRL.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. DQMA-QKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. DQMA-QKSQ.

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM15 peptidase (M12.215) cleavage..

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by ADAM28 peptidase (M12.224) cleavage..

Low affinity immunoglobulin epsilon Fc receptor is proteolytically cut by peptidase 1 (C01.073) cleavage. GSAE-SMGP.