cDNA FLJ78508

UniProt : A8K7C2, P63261, UniProt ID: A8K7C2_HUMAN, ACTG_HUMAN,

cDNA FLJ78508

Homo sapiens

MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ78508 contains a PF00022 domain.

cDNA FLJ78508 is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. DMEK-IWHH.

cDNA FLJ78508 is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. NREK-MTQI.

cDNA FLJ78508 is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. YLMK-ILTE.

cDNA FLJ78508 is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. SLEK-SYEL.