Actin, gamma, cytoplasmic 1

UniProt : P63260, Q4KL81, UniProt ID: ACTG_MOUSE, Q4KL81_MOUSE,

Actin, gamma, cytoplasmic 1

Mus musculus

MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Actin, gamma, cytoplasmic 1 contains a PF00022 domain.

Actin, gamma, cytoplasmic 1 is proteolytically cut by caspase-1 (C14.001) cleavage. LVID-NGSG.

Actin, gamma, cytoplasmic 1 is proteolytically cut by caspase-1 (C14.001) cleavage. ELPD-GQVI.