Zinc finger protein 646

UniProt : O15015, UniProt ID: ZN646_HUMAN,

Zinc finger protein 646

Homo sapiens

MEDTPPSLSCSDCQRHFPSLPELSRHRELLHPSPNQDSEEADSIPRPYRCQQCGRGYRHP
GSLVNHRRTHETGLFPCTTCGKDFSNPMALKSHMRTHAPEGRRRHRPPRPKEATPHLQGE
TVSTDSWGQRLGSSEGWENQTKHTEETPDCESVPDPRAASGTWEDLPTRQREGLASHPGP
EDGADGWGPSTNSARAPPLPIPASSLLSNLEQYLAESVVNFTGGQEPTQSPPAEEERRYK
CSQCGKTYKHAGSLTNHRQSHTLGIYPCAICFKEFSNLMALKNHSRLHAQYRPYHCPHCP
RVFRLPRELLEHQQSHEGERQEPRWEEKGMPTTNGHTDESSQDQLPSAQMLNGSAELSTS
GELEDSGLEEYRPFRCGDCGRTYRHAGSLINHRKSHQTGVYPCSLCSKQLFNAAALKNHV
RAHHRPRQGVGENGQPSVPPAPLLLAETTHKEEEDPTTTLDHRPYKCSECGRAYRHRGSL
VNHRHSHRTGEYQCSLCPRKYPNLMALRNHVRVHCKAARRSADIGAEGAPSHLKVELPPD
PVEAEAAPHTDQDHVCKHEEEATDITPAADKTAAHICSICGLLFEDAESLERHGLTHGAG
EKENSRTETTMSPPRAFACRDCGKSYRHSGSLINHRQTHQTGDFSCGACAKHFHTMAAMK
NHLRRHSRRRSRRHRKRAGGASGGREAKLLAAESWTRELEDNEGLESPQDPSGESPHGAE
GNLESDGDCLQAESEGDKCGLERDETHFQGDKESGGTGEGLERKDASLLDNLDIPGEEGG
GTHFCDSLTGVDEDQKPATGQPNSSSHSANAVTGWQAGAAHTCSDCGHSFPHATGLLSHR
PCHPPGIYQCSLCPKEFDSLPALRSHFQNHRPGEATSAQPFLCCLCGMIFPGRAGYRLHR
RQAHSSSGMTEGSEEEGEEEGVAEAAPARSPPLQLSEAELLNQLQREVEALDSAGYGHIC
GCCGQTYDDLGSLERHHQSQSSGTTADKAPSPLGVAGDAMEMVVDSVLEDIVNSVSGEGG
DAKSQEGAGTPLGDSLCIQGGESLLEAQPRPFRCNQCGKTYRHGGSLVNHRKIHQTGDFL
CPVCSRCYPNLAAYRNHLRNHPRCKGSEPQVGPIPEAAGSSELQVGPIPEGGSNKPQHMA
EEGPGQAEVEKLQEELKVEPLEEVARVKEEVWEETTVKGEEIEPRLETAEKGCQTEASSE
RPFSCEVCGRSYKHAGSLINHRQSHQTGHFGCQACSKGFSNLMSLKNHRRIHADPRRFRC
SECGKAFRLRKQLASHQRVHMERRGGGGTRKATREDRPFRCGQCGRTYRHAGSLLNHRRS
HETGQYSCPTCPKTYSNRMALKDHQRLHSENRRRRAGRSRRTAVRCALCGRSFPGRGSLE
RHLREHEETEREPANGQGGLDGTAASEANLTGSQGLETQLGGAEPVPHLEDGVPRPGERS
QSPIRAASSEAPEPLSWGAGKAGGWPVGGGLGNHSGGWVPQFLTRSEEPEDSVHRSPCHA
GDCQLNGPTLSHMDSWDNRDNSSQLQPGSHSSCSQCGKTYCQSGSLLNHNTNKTDRHYCL
LCSKEFLNPVATKSHSHNHIDAQTFACPDCGKAFESHQELASHLQAHARGHSQVPAQMEE
ARDPKAGTGEDQVVLPGQGKAQEAPSETPRGPGESVERARGGQAVTSMAAEDKERPFRCT
QCGRSYRHAGSLLNHQKAHTTGLYPCSLCPKLLPNLLSLKNHSRTHTDPKRHCCSICGKA
FRTAARLEGHGRVHAPREGPFTCPHCPRHFRRRISFVQHQQQHQEEWTVAGSGRGHEGSQ
EEVGTQWRGKSSPKVGGGARSERREPRGF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 contains a PF00096 domain.

Zinc finger protein 646 is proteolytically cut by caspase () cleavage. MVVD-SVLE.