cDNA FLJ76122, highly similar to Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, mRNA (Nucleophosmin (Nucleolar phosphoprotein B23, numatrin), isoform CRA_a)

UniProt : A8K3N7, P06748, UniProt ID: A8K3N7_HUMAN, NPM_HUMAN,

cDNA FLJ76122, highly similar to Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, mRNA (Nucleophosmin (Nucleolar phosphoprotein B23, numatrin), isoform CRA_a)

Homo sapiens

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76122, highly similar to Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, mRNA (Nucleophosmin (Nucleolar phosphoprotein B23, numatrin), isoform CRA_a) contains a PF03066 domain.

cDNA FLJ76122, highly similar to Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, mRNA (Nucleophosmin (Nucleolar phosphoprotein B23, numatrin), isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VEED-AESE.