Coiled-coil domain-containing protein 104

UniProt : Q96G28, UniProt ID: CC104_HUMAN,

Coiled-coil domain-containing protein 104

Homo sapiens

MAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKEL
VEKLLEGYLKEIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEM
QLQAIRIIQERNGVLPDCLTDGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRKKQL
SEAKTEEPTVHSSEAAIMNNSQGDGEHFAHPPSEVKMHFANQSIEPLGRKVERSETSSLP
QKDLKIPGLEHASIEGPIANLSVLGTEELRQREHYLKQKRDKLMSMRKDMRTKQIQNMEQ
KGKPTGEVEEMTEKPEMTAEEKQTLLKRRLLAEKLKEEVINK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Coiled-coil domain-containing protein 104 is proteolytically cut by caspase () cleavage. DGSD-VVSD.

Coiled-coil domain-containing protein 104 is proteolytically cut by caspase () cleavage. DGSD-VVSD.

Coiled-coil domain-containing protein 104 is proteolytically cut by caspase () cleavage. DEVD-GGPP.