cDNA FLJ78509, highly similar to Homo sapiens transcription elongation factor A (SII), 1 (TCEA1), transcript variant 1, mRNA
UniProt : A8K339, P23193, UniProt ID: A8K339_HUMAN, TCEA1_HUMAN, cDNA FLJ78509, highly similar to Homo sapiens transcription elongation factor A (SII), 1 (TCEA1), transcript variant 1, mRNA Homo sapiens MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDE EVTSLAKSLIKSWKKLLDGPSTEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEI RNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF C The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA FLJ78509, highly similar to Homo sapiens transcription elongation factor A (SII), 1 (TCEA1), transcript variant 1, mRNA contains a PF01096 domain.
cDNA FLJ78509, highly similar to Homo sapiens transcription elongation factor A (SII), 1 (TCEA1), transcript variant 1, mRNA contains a PF08711 domain.
cDNA FLJ78509, highly similar to Homo sapiens transcription elongation factor A (SII), 1 (TCEA1), transcript variant 1, mRNA contains a PF07500 domain.
cDNA FLJ78509, highly similar to Homo sapiens transcription elongation factor A (SII), 1 (TCEA1), transcript variant 1, mRNA is proteolytically cut by calpain-2 (C02.002) cleavage..
cDNA FLJ78509, highly similar to Homo sapiens transcription elongation factor A (SII), 1 (TCEA1), transcript variant 1, mRNA is proteolytically cut by caspase-3 (C14.003) cleavage..