Major core protein P4b

UniProt : P06440, UniProt ID: VP4B_VACCV,

Major core protein P4b

Vaccinia virus (strain Western Reserve / WR)

MEAVVNSDVFLTSNAGLKSSYTNQTLSLVDEDHIHTSDKSLSCSVCNSLSQIVDDDFISA
GARNQRTKPKRAGNNQSQQPIKKDCMVSIDEVASTHDWSTRLRNDGNAIAKYLTTNKYDT
SQFTIQDMLNIMNKLNIVRTNRNELFQLLTHVKSTLNNASVSVKCTHPLVLIHSRASPRI
GDQLKELDKIYSPSNHHILLSTTRFQSMHFTDMSSSQDLSFIYRKPETNYYIHPILMALF
GIKLPALENAYVHGDTYSLIQQLYEFRKVKSYNYMLLVNRLTEDNPIVITGVSDLISTEI
QRANMHTMIRKAIMNIIMGIFYCNDDDAVDPHLMKIIHTGCSQVMTDEEQILASILSIVG
FRPTLVSVARPINGISYDMKLQAAPYIVVNPMKMITTSDSPISINSKDIYSMAFDGNSGR
VVFAPPNIGYGRCSGVTHIDPLGTNVMGSAVHSPVIVNGAMMFYVERRQNKNMFGGECYT
GFRSLIDDTPIDVSPEIMLNGIMYRLKSAVCYKLGDQFFDCGSSDIFLKGHYTILFTENG
PWMYDLSVFNPGARNARLMRALKNQYKKLSMDSDDGFYEWLNGDGSVFAASKQQMLMNHV
ANFDDDLLTMEEAMSMISRHCCILIYAQDYDQYISARHITELF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Major core protein P4b contains a PF03292 domain.

Major core protein P4b is proteolytically cut by vaccinia virus I7L processing peptidase (C57.001) cleavage. ISAG-ARNQ.