Lantibiotic epidermin

UniProt : P08136, UniProt ID: LANE_STAEP,

Lantibiotic epidermin

Staphylococcus epidermidis

MEAVKEKNDLFNLDVKVNAKESNDSGAEPRIASKFICTPGCAKTGSFNSYCC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Lantibiotic epidermin contains a PF02052 domain.

Lantibiotic epidermin is proteolytically cut by EciP lantibiotic leader peptidase (S08.087) cleavage. AEPR-IASK.

Lantibiotic epidermin is proteolytically cut by EpiP lantibiotic leader peptidase (S08.060) cleavage. AEPR-IASK.