GRAP2 protein (GRB2-related adaptor protein 2, isoform CRA_a) (cDNA, FLJ93267, Homo sapiens GRB2-related adaptor protein 2 (GRAP2), mRNA)

UniProt : O75791, Q6FI14, UniProt ID: GRAP2_HUMAN, Q6FI14_HUMAN,

GRAP2 protein (GRB2-related adaptor protein 2, isoform CRA_a) (cDNA, FLJ93267, Homo sapiens GRB2-related adaptor protein 2 (GRAP2), mRNA)

Homo sapiens

MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

GRAP2 protein (GRB2-related adaptor protein 2, isoform CRA_a) (cDNA, FLJ93267, Homo sapiens GRB2-related adaptor protein 2 (GRAP2), mRNA) contains a PF00017 domain.

GRAP2 protein (GRB2-related adaptor protein 2, isoform CRA_a) (cDNA, FLJ93267, Homo sapiens GRB2-related adaptor protein 2 (GRAP2), mRNA) contains a PF00018 domain.

GRAP2 protein (GRB2-related adaptor protein 2, isoform CRA_a) (cDNA, FLJ93267, Homo sapiens GRB2-related adaptor protein 2 (GRAP2), mRNA) contains a PF00018 domain.

GRAP2 protein (GRB2-related adaptor protein 2, isoform CRA_a) (cDNA, FLJ93267, Homo sapiens GRB2-related adaptor protein 2 (GRAP2), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. DIND-GHCG.

GRAP2 protein (GRB2-related adaptor protein 2, isoform CRA_a) (cDNA, FLJ93267, Homo sapiens GRB2-related adaptor protein 2 (GRAP2), mRNA) is proteolytically cut by caspase-9 (C14.010) cleavage..

GRAP2 protein (GRB2-related adaptor protein 2, isoform CRA_a) (cDNA, FLJ93267, Homo sapiens GRB2-related adaptor protein 2 (GRAP2), mRNA) is proteolytically cut by caspase-7 (C14.004) cleavage..