72 kDa type IV collagenase

UniProt : P08253, UniProt ID: MMP2_HUMAN,

72 kDa type IV collagenase

Homo sapiens

MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

72 kDa type IV collagenase contains a PF00040 domain.

72 kDa type IV collagenase contains a PF00045 domain.

72 kDa type IV collagenase contains a PF00045 domain.

72 kDa type IV collagenase contains a PF00413 domain.

72 kDa type IV collagenase contains a PF01471 domain.

72 kDa type IV collagenase contains a PF00045 domain.

72 kDa type IV collagenase contains a PF00045 domain.

72 kDa type IV collagenase contains a PF00040 domain.

72 kDa type IV collagenase contains a PF00040 domain.

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-2 (M10.015) cleavage..

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-2 (M10.015) cleavage..

72 kDa type IV collagenase is proteolytically cut by streptopain (C10.001) cleavage..

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-2 (M10.015) cleavage..

72 kDa type IV collagenase is proteolytically cut by streptopain (C10.001) cleavage..

72 kDa type IV collagenase is proteolytically cut by matrix metallopeptidase-22 (M10.027) cleavage..

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-2 (M10.015) cleavage..

72 kDa type IV collagenase is proteolytically cut by streptopain (C10.001) cleavage..

72 kDa type IV collagenase is proteolytically cut by matrix metallopeptidase-22 (M10.027) cleavage..

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. ESCN-LFVL.

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. DVAN-YNFF.

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. ESCN-LFVL.

72 kDa type IV collagenase is proteolytically cut by neutrophil elastase (S01.131) cleavage. LGPV-TPEI.

72 kDa type IV collagenase is proteolytically cut by neutrophil elastase (S01.131) cleavage. ATTA-NYDD.

72 kDa type IV collagenase is proteolytically cut by neutrophil elastase (S01.131) cleavage. PETA-MSTV.

72 kDa type IV collagenase is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DVAN-YNFF.

72 kDa type IV collagenase is proteolytically cut by furin (S08.071) cleavage. RKPR-CGNP.

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. DVAN-YNFF.

72 kDa type IV collagenase is proteolytically cut by plasmin (S01.233) cleavage..

72 kDa type IV collagenase is proteolytically cut by MT-MMP () cleavage. APSP-IIKF.

72 kDa type IV collagenase is proteolytically cut by MT-MMP () cleavage. AVQY-LNTF.

72 kDa type IV collagenase is proteolytically cut by MT-MMP () cleavage. YLNT-FYGC.

72 kDa type IV collagenase is proteolytically cut by MT-MMP () cleavage. ESCN-LFVL.

72 kDa type IV collagenase is proteolytically cut by MT-MMP () cleavage. KMQK-FFGL.

72 kDa type IV collagenase is proteolytically cut by MT-MMP () cleavage. FGLP-QTGD.

72 kDa type IV collagenase is proteolytically cut by MT-MMP () cleavage. DVAN-YNFF.

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-4 (M10.017) cleavage..

72 kDa type IV collagenase is proteolytically cut by membrane-type matrix metallopeptidase-2 (M10.015) cleavage..