Homo sapiens

MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by furin (S08.071) cleavage. RSKR-ALEN.

is proteolytically cut by furin (S08.071) cleavage. RENR-CQCA.

is proteolytically cut by furin (S08.071) cleavage. KIRR-SSEE.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. TPEH-VVPY.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. YGLG-SPRS.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. CHLD-IIWV.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. HLDI-IWVN.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. ECVY-FCHL.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. CVYF-CHLD.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. RSKR-ALEN.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. SCSS-LMDK.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. DIIW-VNTP.

is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. RSKR-CSCS.

is proteolytically cut by proprotein convertase 7 (S08.077) cleavage. RSKR-ALEN.

is proteolytically cut by chymase (S01.140) cleavage. VVPY-GLGS.

is proteolytically cut by Kell blood-group protein (M13.090) cleavage. DIIW-VNTP.

is proteolytically cut by proprotein convertase 7 (S08.077) cleavage. RSKR-CSCS.

is proteolytically cut by proprotein convertase 7 (S08.077) cleavage. KIRR-SSEE.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. VPYG-LGSP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VPYG-LGSP.