EDN1 protein (Endothelin 1, isoform CRA_b) (cDNA FLJ75736, highly similar to Homo sapiens endothelin 1 (EDN1), mRNA)

UniProt : P05305, Q6FH53, UniProt ID: EDN1_HUMAN, Q6FH53_HUMAN,

EDN1 protein (Endothelin 1, isoform CRA_b) (cDNA FLJ75736, highly similar to Homo sapiens endothelin 1 (EDN1), mRNA)

Homo sapiens

MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

EDN1 protein (Endothelin 1, isoform CRA_b) (cDNA FLJ75736, highly similar to Homo sapiens endothelin 1 (EDN1), mRNA) contains a PF00322 domain.

EDN1 protein (Endothelin 1, isoform CRA_b) (cDNA FLJ75736, highly similar to Homo sapiens endothelin 1 (EDN1), mRNA) is proteolytically cut by furin (S08.071) cleavage. RSKR-CSCS.