3-hydroxyacyl-CoA dehydrogenase type-2

UniProt : O08756, UniProt ID: HCD2_MOUSE,

3-hydroxyacyl-CoA dehydrogenase type-2

Mus musculus

MAAAVRSVKGLVAVVTGGASGPWLATAKRLVGQGATAVLLDVPDSEGESQAKKLGESCIF
APANVTSEKEIQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHQKKNKIHTLEDFQRVINV
NLIGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIDGMTL
PIARDLAPTGIRVVTIAPGLFATPLLTTLPEKVRNFLASQVPFPSRLGDPAEYAHLVQTI
IENPFLNGEVIRLDGAIRMQP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

3-hydroxyacyl-CoA dehydrogenase type-2 contains a PF00106 domain.

3-hydroxyacyl-CoA dehydrogenase type-2 is proteolytically cut by caspase-1 (C14.001) cleavage. HLVQ-TIIE.