Putative uncharacterized protein MAP4K1 (Mitogen-activated protein kinase kinase kinase kinase 1, isoform CRA_b)

UniProt : A8MWC4, UniProt ID: A8MWC4_HUMAN,

Putative uncharacterized protein MAP4K1 (Mitogen-activated protein kinase kinase kinase kinase 1, isoform CRA_b)

Homo sapiens

MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQ
KEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCRE
VLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMA
PEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEK
GKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLNRGLILDLLDKLKNPGKGPSI
GDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQP
PRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQL
SPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMK
RKGCALLVKLFNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPS
RTTWVYSINNVLMSLSGKTPHLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTK
IQDTKGCRACCVAEGASSGGPFLCGALETSVVLLQWYQPMNKFLLVRQVLFPLPTPLSVF
ALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWLGEMSTEHRGPVQVTQVEEDM
VMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHGVQVWALGSDQ
LLQELRDPTLTFRLLGSPRPVVVETRPVDDPTAPSNLYIQE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein MAP4K1 (Mitogen-activated protein kinase kinase kinase kinase 1, isoform CRA_b) contains a PF00069 domain.

Putative uncharacterized protein MAP4K1 (Mitogen-activated protein kinase kinase kinase kinase 1, isoform CRA_b) contains a PF00780 domain.

Putative uncharacterized protein MAP4K1 (Mitogen-activated protein kinase kinase kinase kinase 1, isoform CRA_b) is proteolytically cut by () cleavage..