Complement C1q subcomponent subunit C

UniProt : P02747, UniProt ID: C1QC_HUMAN,

Complement C1q subcomponent subunit C

Homo sapiens

MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEP
GIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQS
VFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCV
LLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGF
LLFPD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Complement C1q subcomponent subunit C contains a PF00386 domain.

Complement C1q subcomponent subunit C contains a PF01391 domain.

Complement C1q subcomponent subunit C is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPKG-QKGE.

Complement C1q subcomponent subunit C is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPPG-MPGV.

Complement C1q subcomponent subunit C is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-MPGV.