cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b)

UniProt : A8K2A4, P37840, UniProt ID: A8K2A4_HUMAN, SYUA_HUMAN,

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b)

Homo sapiens

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) contains a PF01387 domain.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by calpain-1 (C02.001) cleavage. KGLS-KAKE.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by calpain-1 (C02.001) cleavage. DPDN-EAYE.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by calpain-1 (C02.001) cleavage. KGLS-KAKE.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by calpain-1 (C02.001) cleavage. DPDN-EAYE.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GVAT-VAEK.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. TAVA-QKTV.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AATG-FVKK.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AVAQ-KTVE.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. IAAA-TGFV.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. TAVA-QKTV.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AVAQ-KTVE.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. IAAA-TGFV.

cDNA FLJ76529, highly similar to Homo sapiens synuclein, alpha (non A4 component of amyloid) (SNCA), transcript variant NACP140, mRNA (Synuclein, alpha (Non A4 component of amyloid), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AATG-FVKK.