Receptor-type tyrosine-protein phosphatase kappa

UniProt : P35822, UniProt ID: PTPRK_MOUSE,

Receptor-type tyrosine-protein phosphatase kappa

Mus musculus

MDVAAAALPAFVALWLLYPWPLLGSALGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVS
AQEPHYLPPEMPQGSYMVVDSSNHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPG
TLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYIA
IDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPVA
QTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAQLIVREPPRPIAPPQLL
GVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLDPDTEYEI
RVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRCH
TFNVTICYHYFRGHNESRADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEET
IIQTDEDVPGPVPVKSLQGTSFENKIFLNWKEPLEPNGIITQYEVSYSSIRSFDPAVPVA
GPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRASTVKGFGPATAINVTTNISAPSLPDYEG
VDASLNETATTITVLLRPAQAKGAPISAYQIVVEQLHPHRTKREAGAMECYQVPVTYQNA
LSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYKGFWNPPLAPRKGYNIYFQAMSSVEKET
KTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVIVIVKKSKLA
KKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSLTFMDQHNFSPRLPNDPLVPTA
VLDENHSATAESSRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFK
EEYESFFEGQSASWDVAKKDQNRAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDI
WLYRDGYQRPSHYIATQGPVHETVYDFWRMVWQEQSACIVMVTNLVEVGRVKCYKYWPDD
TEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPDHGVPYHATGLLS
FIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSRRI
NMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNS
VTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPA
AFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEVDLSQGCPQYWPEEGMLRYGPIQVECM
SCSMDCDVINRIFRICNLTRPQEGYLMVQQFQYLGWASHREVPGSKRSFLKLILQVEKWQ
EECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKPNMVEAP
EQYRFCYDVALEYLESS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Receptor-type tyrosine-protein phosphatase kappa contains a PF00041 domain.

Receptor-type tyrosine-protein phosphatase kappa contains a PF00102 domain.

Receptor-type tyrosine-protein phosphatase kappa contains a PF00629 domain.

Receptor-type tyrosine-protein phosphatase kappa contains a PF00102 domain.

Receptor-type tyrosine-protein phosphatase kappa contains a PF00047 domain.

Receptor-type tyrosine-protein phosphatase kappa contains a PF00041 domain.

Receptor-type tyrosine-protein phosphatase kappa is proteolytically cut by furin (S08.071) cleavage. RTKR-EAGA.

Receptor-type tyrosine-protein phosphatase kappa is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..

Receptor-type tyrosine-protein phosphatase kappa is proteolytically cut by presenilin 1 (A22.001) cleavage. RTKR-EAGA.