Tartrate-resistant acid phosphatase type 5

UniProt : P29288, UniProt ID: PPA5_RAT,

Tartrate-resistant acid phosphatase type 5

Rattus norvegicus

MDTWMVLLGLQILLLPLLAHCTAPASTLRFVAVGDWGGVPNAPFHTAREMANAKEIARTV
QIMGADFIMSLGDNFYFTGVHDANDKRFQETFEDVFSDRALRNIPWYVLAGNHDHLGNVS
AQIAYSKISKRWNFPSPYYRLRFKVPRSNITVAIFMLDTVMLCGNSDDFVSQQPEMPRDL
GVARTQLSWLKKQLAAAKEDYVLVAGHYPIWSIAEHGPTRCLVKNLRPLLAAYGVTAYLC
GHDHNLQYLQDENGVGYVLSGAGNFMDPSVRHQRKVPNGYLRFHYGSEDSLGGFTYVEIG
SKEMSITYVEASGKSLFKTSLPRRPRP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tartrate-resistant acid phosphatase type 5 contains a PF00149 domain.

Tartrate-resistant acid phosphatase type 5 is proteolytically cut by trypsin () cleavage. EMPR-DLGV.