EBNA1 binding protein 2

UniProt : A2ACZ0, Q9D903, UniProt ID: A2ACZ0_MOUSE, EBP2_MOUSE,

EBNA1 binding protein 2

Mus musculus

MDTPPLSESDSESDACLASDQELQDAFSRGLLKPGLNVVLEKPKKAVNDVSGLKQCLAEF
RRDLEWVERLDVTLGPVPEVSETQPTPQNQDQKKGVNPEDDFQREMSFYRQAQAAVLAVL
PRLHQLQVPTKRPTDYFAEMAKSDQQMQKIRQKLQTKQAAMEKSEKAKQLRALRKYGKKV
QTEVLQKRQREKAHMMNAIKKYQKGFSDKLDFLEGDQKPVERSAKAGGKGQQMSKGPNAK
RRYKNQKFGFGGKKKGSKWNTKESYDDVSSFRAKVAHGKGSRRPGKKGANKRPGKRARQK
LKSKAR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

EBNA1 binding protein 2 contains a PF05890 domain.

EBNA1 binding protein 2 is proteolytically cut by caspase-1 (C14.001) cleavage. SDAC-LASD.