Retinoid X receptor, alpha (Retinoid X receptor, alpha, isoform CRA_b)

UniProt : P19793, Q2NL52, UniProt ID: Q2NL52_HUMAN, RXRA_HUMAN,

Retinoid X receptor, alpha (Retinoid X receptor, alpha, isoform CRA_b)

Homo sapiens

MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Retinoid X receptor, alpha (Retinoid X receptor, alpha, isoform CRA_b) contains a PF00104 domain.

Retinoid X receptor, alpha (Retinoid X receptor, alpha, isoform CRA_b) contains a PF00105 domain.

Retinoid X receptor, alpha (Retinoid X receptor, alpha, isoform CRA_b) is proteolytically cut by cathepsin L (C01.032) cleavage..