BH3-interacting domain death agonist

UniProt : P70444, UniProt ID: BID_MOUSE,

BH3-interacting domain death agonist

Mus musculus

MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDG
SQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSE
EDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQ
NLFSYVRNLVRNEMD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

BH3-interacting domain death agonist contains a PF06393 domain.

BH3-interacting domain death agonist is proteolytically cut by cathepsin B (C01.060) cleavage. QASR-SFNQ.

BH3-interacting domain death agonist is proteolytically cut by cathepsin L (C01.032) cleavage. QASR-SFNQ.

BH3-interacting domain death agonist is proteolytically cut by cathepsin K (C01.036) cleavage. QASR-SFNQ.

BH3-interacting domain death agonist is proteolytically cut by cathepsin S (C01.034) cleavage. QASR-SFNQ .

BH3-interacting domain death agonist is proteolytically cut by cathepsin H (C01.040) cleavage. NQGR-IEPD.

BH3-interacting domain death agonist is proteolytically cut by cathepsin B (C01.060) cleavage. ASRS-FNQG.

BH3-interacting domain death agonist is proteolytically cut by cathepsin B (C01.060) cleavage. SRSF-NQGR.

BH3-interacting domain death agonist is proteolytically cut by cathepsin K (C01.036) cleavage. SGLG-AEHI.

BH3-interacting domain death agonist is proteolytically cut by cathepsin S (C01.034) cleavage. SGLG-AEHI.

BH3-interacting domain death agonist is proteolytically cut by cathepsin S (C01.034) cleavage. VQAY-WEAD.

BH3-interacting domain death agonist is proteolytically cut by cathepsin S (C01.034) cleavage. DELQ-TDGS .

BH3-interacting domain death agonist is proteolytically cut by cathepsin H (C01.040) cleavage. SEVS-NGSG.

BH3-interacting domain death agonist is proteolytically cut by cathepsin H (C01.040) cleavage. SGLG-AEHI.

BH3-interacting domain death agonist is proteolytically cut by cathepsin H (C01.040) cleavage. VQAY-WEAD.

BH3-interacting domain death agonist is proteolytically cut by caspase-8 (C14.009) cleavage..

BH3-interacting domain death agonist is proteolytically cut by caspase-2 (C14.006) cleavage..