Leucine-rich repeats and calponin homology (CH) domain containing 4

UniProt : A4D2D5, O75427, UniProt ID: A4D2D5_HUMAN, LRCH4_HUMAN,

Leucine-rich repeats and calponin homology (CH) domain containing 4

Homo sapiens

MAAAVAAPLAAGGEEAAATTSVPGSPGLPGRRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSLLPPYICQLPLRVLIVSNNKLGALPPDIGTLGSLRQLDVSSNELQSLPSELCG
LSSLRDLNVRRNQLSTLPEELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQVCLKGKLHIFKYLSTEAGQRGSALGDLAPSRPPSFSPCPAEDLFPGHRYDGGLDS
GFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSH
VPGEDEERGTVEEQRPPELSPGAGDRERAPSSRREEPAGEERRRPDTLQLWQERERRQQQ
QSGAWGAPRKDSLLKPGLRAVVGGAAAVSTQAMHNGSPKSSASQAGAAAGQGAPAPAPAS
QEPLPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDL
MTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVPSPAVPKLSALKA
RKNVESFLEACRKMGVPEADLCSPSDLLQGTARGLRTALEAVKRVGGKALPPLWPPSGLG
GFVVFYVVLMLLLYVTYTRLLGS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Leucine-rich repeats and calponin homology (CH) domain containing 4 contains a PF00307 domain.

Leucine-rich repeats and calponin homology (CH) domain containing 4 contains a PF00560 domain.

Leucine-rich repeats and calponin homology (CH) domain containing 4 contains a PF00560 domain.

Leucine-rich repeats and calponin homology (CH) domain containing 4 contains a PF00560 domain.

Leucine-rich repeats and calponin homology (CH) domain containing 4 contains a PF00560 domain.

Leucine-rich repeats and calponin homology (CH) domain containing 4 contains a PF00560 domain.

Leucine-rich repeats and calponin homology (CH) domain containing 4 contains a PF00560 domain.

Leucine-rich repeats and calponin homology (CH) domain containing 4 is proteolytically cut by caspase () cleavage. DFID-SHVP.