Neuroendocrine secretory protein 55

UniProt : O18979, UniProt ID: GNAS3_BOVIN,

Neuroendocrine secretory protein 55

Bos taurus

MDRRSRPQLGRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSSTRAQQRAAAQR
RTFLNAHHRSAAQVFPEPPESDHEDTDFEPSLPECPEYQEEEFDYESETESESEIESETE
FETESDTAPTTEPETEPEDEPGPVVPKRPTFHQSLTERLSALRLRSPDASPSRAPPSTQE
SESPRQGEEPEDKDPRDPEESEEPKEEEKQQQHRCKPKKPTRRDPSPESPSKRGAIPIRR
H

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Neuroendocrine secretory protein 55 contains a PF06390 domain.

Neuroendocrine secretory protein 55 is proteolytically cut by () cleavage..