Renin-2

UniProt : P00796, UniProt ID: RENI2_MOUSE,

Renin-2

Mus musculus

MDRRRMPLWALLLLWSPCTFSLPTGTTFERIPLKKMPSVREILEERGVDMTRLSAEWDVF
TKRSSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLA
CGIHSLYESSDSSSYMENGDDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLI
PFMLAQFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEKVFSVYYNRGPHLLGGEVVLGG
SDPEHYQGDFHYVSLSKTDSWQITMKGVSVGSSTLLCEEGCEVVVDTGSSFISAPTSSLK
LIMQALGAKEKRLHEYVVSCSQVPTLPDISFNLGGRAYTLSSTDYVLQYPNRRDKLCTVA
LHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Renin-2 contains a PF00026 domain.

Renin-2 contains a PF07966 domain.

Renin-2 is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FTKR-SSLT.

Renin-2 is proteolytically cut by kallikrein 13 (S01.173) cleavage. FTKR-SSLT.

Renin-2 is proteolytically cut by kallikrein mK26 (S01.070) cleavage. FTKR-SSLT.