cDNA, FLJ92243, Homo sapiens chemokine (C-C motif) ligand 22 (CCL22), mRNA

UniProt : B2R4W2, UniProt ID: B2R4W2_HUMAN,

cDNA, FLJ92243, Homo sapiens chemokine (C-C motif) ligand 22 (CCL22), mRNA

Homo sapiens

MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSC
PRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92243, Homo sapiens chemokine (C-C motif) ligand 22 (CCL22), mRNA contains a PF00048 domain.

cDNA, FLJ92243, Homo sapiens chemokine (C-C motif) ligand 22 (CCL22), mRNA is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. EAGP-YGAN.

cDNA, FLJ92243, Homo sapiens chemokine (C-C motif) ligand 22 (CCL22), mRNA is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. GPYG-ANME.